PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G293600.1
Common NameB456_008G293600, LOC105765707
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 471aa    MW: 52259.2 Da    PI: 7.708
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G293600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61e-1659103147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r +WT+eE++++++a +++G g W+ I +++g ++t+ q++s+ qk+
  Gorai.008G293600.1  59 REKWTEEEHQKFLEALRLYGRG-WRQIEEHVG-TKTAVQIRSHAQKF 103
                         789*******************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.79E-1653108IPR009057Homeodomain-like
PROSITE profilePS5129421.55154108IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-956105IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-1657106IPR006447Myb domain, plants
SMARTSM007174.5E-1358106IPR001005SANT/Myb domain
PfamPF002491.0E-1459102IPR001005SANT/Myb domain
CDDcd001673.79E-1161104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MATEDQIEST ASPTALKSGV CCSIGSGQSE TLTQLQELYG FKHDHTPKIR KPYTITKQRE  60
KWTEEEHQKF LEALRLYGRG WRQIEEHVGT KTAVQIRSHA QKFFSKVARE SNGGFESSAK  120
SIEIPPPRPK RKPTHPYPRK SVTSLKGISP SSQLERSLSP NHSVSEQDNK SPSSVLSPFV  180
FDAMGSSASE QPNRCSSPTS CTTNIQSLNN TSPVEKENDY VTSMEKETES LSSVKVFGQS  240
SEEDILSLKS NTDFEEPVRA KGNEAAVVVP FTSIKLFGKT VEVKDSSKPS TGAENFQMQT  300
SKNGVAGECL DLHLSHGTVI DNWSTVPPKS NLSPCMEIHT DKNDHVEYTS DAPLPWLAFY  360
QGLPFYYITS FNQTHTDPRV KETPKEKETL NERSCTGSNT GSVSQIENRE RNSDSVDSQC  420
QNPCPRGKMT SQKFSKGFVP YKRCLTERDM SSSMVVSEGR ERAQKARVCS *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00146DAPTransfer from AT1G18330Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012440377.10.0PREDICTED: protein REVEILLE 7-like
TrEMBLA0A0D2TF090.0A0A0D2TF09_G
STRINGPOPTR_0012s03530.11e-121(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM91742738
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18330.16e-54MYB_related family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]